Leifsonia xyli subsp. xyli CTCB07: Lxx19880 Help Entry Lxx19880          CDS       T00190                                  Symbol groES Name (GenBank) 10kDa chaperonin   KO K04078   chaperonin GroES Organism lxx  Leifsonia xyli subsp. xyli CTCB07 Brite KEGG Orthology (KO) [BR:lxx00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:lxx03110]     Lxx19880 (groES)    03029 Mitochondrial biogenesis [BR:lxx03029]     Lxx19880 (groES) Chaperones and folding catalysts [BR:lxx03110]  Heat shock proteins   HSP10    Lxx19880 (groES) Mitochondrial biogenesis [BR:lxx03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     Lxx19880 (groES) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 DUF7205 Motif Other DBs NCBI-ProteinID:  AAT89703 UniProt:  Q6AD41 LinkDB All DBs Position complement(2051609..2051905) Genome browser AA seq 98 aa AA seqDB search MSVSIKPLEDRIVIKQVEAEQTTASGLVIPDTAKEKPQEGVVEAVGPGRIDDNGNRVPLD VAVGDKVIYSKYGGTEVKFGGQDYLVLSARDVLAVVVR NT seq 297 nt NT seq  +upstreamnt  +downstreamnt gtgtcggtctccatcaagccgctcgaagatcgcatcgtcatcaagcaggtcgaggctgag cagaccactgcctccggtctggtcatccccgacaccgccaaggagaagccacaggaaggc gtggtcgaggctgtgggccccggccgcatcgacgacaacggcaaccgcgttccgctcgat gtcgctgtcggcgacaaggtgatatactccaagtacggcggaaccgaggtcaagttcggt ggccaggactacctcgtcctctcggctcgcgacgttctcgcggtcgtcgtgcgctga

DBGET integrated database retrieval system