Protaetiibacter intestinalis: D7I47_12345 Help Entry D7I47_12345       CDS       T05661                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism lyd  Protaetiibacter intestinalis Pathway lyd01100   Metabolic pathways lyd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lyd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     D7I47_12345    00074 Mycolic acid biosynthesis     D7I47_12345   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     D7I47_12345 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Pro_sub2 Motif Other DBs NCBI-ProteinID:  AYF98963 UniProt:  A0A387B9D3 LinkDB All DBs Position complement(2610852..2611097) Genome browser AA seq 81 aa AA seqDB search MALSTEEVLAGLAELINDETGIAADTVELDKSFTDDLDIDSISMMTIVVNAEEKFDVKIP DEEVKNLKTVGDAVSYIVNAS NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggcactgtccaccgaagaagtcctcgccggcctggctgagctcatcaacgacgagacc ggcatcgcggcggacaccgtcgagctcgacaagtcgttcacggacgacctcgacatcgac tccatctcgatgatgaccatcgtggtcaacgccgaggagaagttcgacgtcaagatcccc gacgaggaggtcaagaacctcaagaccgtcggcgacgccgtcagctacatcgtcaacgcc agctag

DBGET integrated database retrieval system