Lysinibacter sp. HNR: FrondiHNR_12720 Help Entry FrondiHNR_12720   CDS       T09375                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism lyh  Lysinibacter sp. HNR Brite KEGG Orthology (KO) [BR:lyh00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:lyh03032]     FrondiHNR_12720    03036 Chromosome and associated proteins [BR:lyh03036]     FrondiHNR_12720    03400 DNA repair and recombination proteins [BR:lyh03400]     FrondiHNR_12720 DNA replication proteins [BR:lyh03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     FrondiHNR_12720 Chromosome and associated proteins [BR:lyh03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     FrondiHNR_12720 DNA repair and recombination proteins [BR:lyh03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       FrondiHNR_12720 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bac_DNA_binding MrpH_C Motif Other DBs NCBI-ProteinID:  WGD37272 LinkDB All DBs Position complement(2835229..2835507) Genome browser AA seq 92 aa AA seqDB search MSLNKTELVAKIAADTGQSQAAVLSVVDKFFATVADAVAADDKVTIPGWIAFESVATSAR TGRNPQTGETINIPAGKRVKVSVGSKLKAAVK NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgtcattgaacaagactgaacttgttgccaaaatcgctgccgacaccggccagagccag gccgctgttctcagcgttgttgataagtttttcgccacagtagcagatgcggttgccgca gatgacaaggtgaccattcccggttggatcgcatttgagtctgttgcaacctcggcccgc accggacgtaacccccagaccggtgagaccatcaacattcctgccggaaagcgcgtcaag gtgagcgttggaagcaagcttaaggcagcggttaagtaa

DBGET integrated database retrieval system