Marilutibacter alkalisoli: FKV23_00775 Help Entry FKV23_00775       CDS       T06167                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism lyj  Marilutibacter alkalisoli Pathway lyj01100   Metabolic pathways lyj01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lyj00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FKV23_00775    00074 Mycolic acid biosynthesis     FKV23_00775   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FKV23_00775 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QDH68807 UniProt:  A0A514BN56 LinkDB All DBs Position 174185..174454 Genome browser AA seq 89 aa AA seqDB search MSVQTAAERELAELLVESLNLEEVAPEGIDPEAPLFGEGLGLDSIDALELALAISKKHGI QLRSDSDENRRIFASLRALAAHIDQQKAA NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgtccgtacaaaccgccgccgaacgcgaactggccgaactgctggtcgagagcctgaac ctggaagaggtggctcccgaagggatcgaccccgaggccccgctgttcggcgagggcctg gggctggattcgatcgatgcgctggagctggcgctggcgatctcgaagaagcacggcatc cagctgcgctcggacagcgacgagaaccgccgcatcttcgcctcgctacgcgcgctggcg gcgcacatcgaccagcagaaggcggcctga

DBGET integrated database retrieval system