Lysinibacillus sp. PLM2: MTP04_08640 Help Entry MTP04_08640       CDS       T09546                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism lyp  Lysinibacillus sp. PLM2 Pathway lyp01100   Metabolic pathways lyp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lyp00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MTP04_08640    00074 Mycolic acid biosynthesis     MTP04_08640   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MTP04_08640 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  BDH60734 LinkDB All DBs Position 878245..878484 Genome browser AA seq 79 aa AA seqDB search MIFNDFCNTIFNLLEREPIAVSKSTNLRDDLDVDSLQMVNLATSLADYYEIPFSLFIERA EMMSTVGGLYEIVKEGVSK NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgatatttaatgatttttgtaatacaatatttaaccttttagaaagagagcctatagca gtttcaaagtctacaaatcttcgagatgatttagatgtggattcacttcaaatggtcaat ctagcaacaagtttagcagattattatgaaattccgtttagtttatttatcgaaagagca gaaatgatgtcaactgttggaggattatacgagatagttaaggaaggtgtatctaagtga

DBGET integrated database retrieval system