Lysinibacillus sp. Ag94: MY533_05240 Help Entry MY533_05240       CDS       T10411                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism lyq  Lysinibacillus sp. Ag94 Pathway lyq02024   Quorum sensing lyq03018   RNA degradation Brite KEGG Orthology (KO) [BR:lyq00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     MY533_05240 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     MY533_05240 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:lyq03019]     MY533_05240 (hfq)    03036 Chromosome and associated proteins [BR:lyq03036]     MY533_05240 (hfq) Messenger RNA biogenesis [BR:lyq03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      MY533_05240 (hfq) Chromosome and associated proteins [BR:lyq03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     MY533_05240 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 LSM Motif Other DBs NCBI-ProteinID:  UPW84279 LinkDB All DBs Position 1181142..1181372 Genome browser AA seq 76 aa AA seqDB search MKSINLQDTFLNHLRKNNVFVTVFLLNGFQLKGTVKSYDNFTVLLLDAESKQHLIYKHAI STFVPAKQIDFLETEE NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgaaatcaattaacttgcaagatacattcttaaaccatctacgtaaaaacaatgttttt gtaactgtgtttttgttaaacggatttcagttaaaaggaactgtgaaatcctatgataat tttacagttttattactagatgctgaaagcaagcaacatcttatttacaaacacgctatt tctacatttgttccagcaaagcaaatagattttttagaaacagaagaatag

DBGET integrated database retrieval system