Lysinibacillus sp. YS11: LBYS11_02600 Help Entry LBYS11_02600      CDS       T05299                                  Name (GenBank) 4-oxalocrotonate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism lys  Lysinibacillus sp. YS11 Pathway lys00362   Benzoate degradation lys00622   Xylene degradation lys01100   Metabolic pathways lys01120   Microbial metabolism in diverse environments lys01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:lys00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     LBYS11_02600    00622 Xylene degradation     LBYS11_02600    00621 Dioxin degradation     LBYS11_02600 Enzymes [BR:lys01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      LBYS11_02600 SSDB OrthologParalogGFIT Motif Pfam:  Tautomerase Tautomerase_2 CHMI Tautomerase_3 PUF MRP-S32 Motif Other DBs NCBI-ProteinID:  AUS85281 LinkDB All DBs Position complement(557657..557842) Genome browser AA seq 61 aa AA seqDB search MPYVTVKMLEGRTEEQKRALVKEVTEAVSRTVNAPAENVTVFIEEMSKNHYGVAGVRFSD K NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atgccatacgtaacagtgaaaatgcttgaaggtcgtacagaggaacaaaaacgtgctctt gtaaaagaagtaacagaagcagtatctcgcacagttaatgcacctgcagaaaatgtaaca gtttttattgaagaaatgtctaaaaaccattacggcgttgcaggcgttcgttttagcgac aaataa

DBGET integrated database retrieval system