KEGG   Lysobacter sp. TY2-98: DWG18_07095
Entry
DWG18_07095       CDS       T05586                                 
Name
(GenBank) response regulator
  KO
K03413  two-component system, chemotaxis family, chemotaxis protein CheY
Organism
lyt  Lysobacter sp. TY2-98
Pathway
lyt02020  Two-component system
lyt02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:lyt00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DWG18_07095
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    DWG18_07095
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:lyt02022]
    DWG18_07095
   02035 Bacterial motility proteins [BR:lyt02035]
    DWG18_07095
Two-component system [BR:lyt02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   DWG18_07095
Bacterial motility proteins [BR:lyt02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    DWG18_07095
SSDB
Motif
Pfam: Response_reg
Other DBs
NCBI-ProteinID: AXK72071
LinkDB
Position
1506188..1506568
AA seq 126 aa
MTDRPKVLLCDDSRALRMLTAQQIDACGYQLAGEADNGVKAVEQYLALKPDVVLLDLVMP
KVDGKAALKRILELDPAAKVVVLSSLGAQNDIEQCLKMGAKSYLQKPIDRDTLARVLAEV
TAATTA
NT seq 381 nt   +upstreamnt  +downstreamnt
atgaccgaccgcccgaaggttctgctctgcgacgactcccgcgcgctgcgcatgctgacc
gcccagcagatcgacgcctgcggctaccagctggcgggtgaagccgacaacggcgtcaag
gcggtcgagcagtacctcgcgctcaagccggatgtcgtgctgctcgacctcgtcatgccg
aaggtcgatggcaaggcggcgctcaagcgcatcctcgaactcgatccggcggcgaaggtc
gtcgtgctcagctcgctcggcgcgcagaacgacatcgagcagtgcctgaagatgggcgcg
aagagctacctgcagaagccgatcgaccgcgacacgctcgcgcgcgtgctggcagaagtc
accgccgccacgaccgcctga

DBGET integrated database retrieval system