Lysobacter sp. TY2-98: DWG18_08490 Help Entry DWG18_08490       CDS       T05586                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism lyt  Lysobacter sp. TY2-98 Pathway lyt01100   Metabolic pathways lyt01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lyt00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DWG18_08490    00074 Mycolic acid biosynthesis     DWG18_08490   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DWG18_08490 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L50 DUF1896 HLH Motif Other DBs NCBI-ProteinID:  AXK72318 LinkDB All DBs Position complement(1783481..1783720) Genome browser AA seq 79 aa AA seqDB search MSTIEERVKKIVVEQLGVKEEDVTTNASFVDDLGADSLDTVELVMALEEEFECEIPDEEA EKITTVQQAIDYVKSHVKS NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagagcgcgtcaagaagatcgtcgtcgaacagctcggcgtgaaggaa gaagacgtcaccaccaacgcttcgttcgttgacgatctgggcgccgactcgctggatacc gtcgagctcgtgatggcgctcgaggaagagttcgagtgcgagatcccggacgaagaagcc gagaagatcaccaccgtgcagcaggccatcgactacgtgaagtcgcacgtcaagtcgtaa

DBGET integrated database retrieval system