Lysobacter sp. CW239: H2514_03925 Help Entry H2514_03925       CDS       T10688                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism lyw  Lysobacter sp. CW239 Brite KEGG Orthology (KO) [BR:lyw00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:lyw03032]     H2514_03925    03036 Chromosome and associated proteins [BR:lyw03036]     H2514_03925    03400 DNA repair and recombination proteins [BR:lyw03400]     H2514_03925 DNA replication proteins [BR:lyw03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     H2514_03925 Chromosome and associated proteins [BR:lyw03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     H2514_03925 DNA repair and recombination proteins [BR:lyw03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       H2514_03925 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 DUF2267 VWA_3 HU-CCDC81_euk_1 Phage_cement_2 Motif Other DBs NCBI-ProteinID:  QOD91799 UniProt:  A0A7L8D0M0 LinkDB All DBs Position 887263..887535 Genome browser AA seq 90 aa AA seqDB search MNKGDFVAAVAEAAELSKTDAASAVDAVISVITKTLKKGETITLVGFGTFEVRKRAARQG RNPKTGEAIKIKASKNPAFKAGKALKDAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaagggtgattttgttgctgctgtcgccgaggctgcagagctgtccaagaccgat gccgccagtgccgtggatgccgtgatcagcgtcatcaccaagacgttgaagaagggcgaa acgatcacgctggtcggcttcggcaccttcgaggttcgcaagcgtgctgcccgtcagggc cgcaatccgaagaccggcgaggccatcaagatcaaggcatcgaaaaatccggcgttcaag gctggcaaagccctgaaggacgctgtaaactaa

DBGET integrated database retrieval system