KEGG   Martelella sp. AD-3: AZF01_10345
Entry
AZF01_10345       CDS       T04332                                 
Name
(GenBank) LPS export ABC transporter permease LptG
  KO
K11720  lipopolysaccharide export system permease protein
Organism
maad  Martelella sp. AD-3
Pathway
maad02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:maad00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    AZF01_10345
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:maad02000]
    AZF01_10345
Transporters [BR:maad02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Lipopolysaccharide transporter
    AZF01_10345
SSDB
Motif
Pfam: LptF_LptG SFXNs
Other DBs
NCBI-ProteinID: AMM84703
LinkDB
Position
2230059..2231129
AA seq 356 aa
MIFSVLGRYFFTRYLITVGWFFFGVISIIYLIDFSEVIGNISVEAGQGTTDAMLITALRL
PYILQQTVPFIALFSAMVALIALNRRNELVVTRSAGISVWQFIMPFVIGAALLGAASVVA
LNPLASWTQKKALGLEAIGHGQDQTVPWLRQLTDGQDTIIGGRGIAESGTELLQAVVIYF
DDQGALFKRQDAERAVLSNGWWTLYDVTETEVGELSTHRDEVRVKTNLDEQFVQQNLVQP
DLVSIFALPRQIDLARQFGISSKALETQYNYLLSLPFLLVAMTLIAATVCLKFSRFAQSP
AVILGGILSGFLLYVTSVLVKAFGSSGVLSPLLAAWIPVVVAMALGLTILLHQEDG
NT seq 1071 nt   +upstreamnt  +downstreamnt
atgatcttctccgttctcggtcgctatttcttcacgcgctatctgataacggtcggctgg
ttctttttcggcgtgatctcgatcatctacctgatcgacttttccgaggtcatcggcaac
atctctgtcgaggccggccagggcacgacggacgcgatgctgatcacggcgctgcgcctg
ccctatatcctgcagcagacggtccccttcatcgcgctgttttccgccatggttgccctg
atcgcgctcaaccgtcgcaacgaactggtcgtcacccgctccgccggcatttccgtgtgg
cagttcatcatgcccttcgtcatcggcgcggcgctgctcggcgcggcaagcgtcgttgcg
ctcaatccgcttgcctcctggacccagaaaaaggcgctcgggctcgaggcgatcggccat
ggccaggaccagaccgtgccctggctgcggcagctgaccgacggtcaggatacgattatc
ggcggccgcggcatcgccgagagcggaaccgaactcctgcaggccgtggtgatctacttc
gatgatcagggcgcgctcttcaaacgccaggacgccgaaagggccgtgctcagcaatggc
tggtggacgctttacgacgtgaccgaaaccgaggtcggcgaattatccacacatcgggac
gaggtccgcgtcaaaaccaatctcgacgagcagttcgtccagcagaacctcgtccagcca
gaccttgtgagcatttttgcactgccgagacaaattgacctcgcccgccagttcggaatt
tcgtcaaaagctttggaaacgcagtataactatttgttatccctacctttccttttggtg
gcgatgacccttatcgcagccacggtctgccttaagttttcgcgcttcgcgcagtctccg
gccgttattttgggtggaatcctgtccggctttctgctttatgtgacgagtgttcttgta
aaggcgtttggcagcagcggagttttgtcgccgcttcttgcggcctggattccggtggtc
gtggcgatggctttgggtctgacgatattactgcatcaggaggacggttag

DBGET integrated database retrieval system