Mycobacteroides abscessus ATCC 19977: MAB_2250 Help Entry MAB_2250          CDS       T00657                                  Name (GenBank) Putative MbtH family protein   KO K05375   MbtH protein Organism mab  Mycobacteroides abscessus ATCC 19977 Pathway mab00261   Monobactam biosynthesis mab01100   Metabolic pathways mab01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mab00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     MAB_2250  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:mab01008]     MAB_2250 Polyketide biosynthesis proteins [BR:mab01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     MAB_2250 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  CAM62331 UniProt:  B1MAR0 LinkDB All DBs Position 2281736..2281963 Genome browser AA seq 75 aa AA seqDB search MKGKLLSTNPFDDENGTFYVLVNDEEQYSLWPNAIEIPERWRVVFGAASRADCVEYVEAN WLDMRPKSLRDVMAG NT seq 228 nt NT seq  +upstreamnt  +downstreamnt gtgaaaggaaaattgttgagtaccaacccatttgatgacgagaacggcaccttctacgtt ctggtcaacgacgaggagcagtacagtttgtggcccaacgccatcgagatcccggagcgg tggcgagtggtcttcggtgcggcctcgcgggctgactgtgtggaatacgtcgaggccaac tggctcgatatgcgacccaagagcctgcgcgacgtgatggcgggatag

DBGET integrated database retrieval system