Methanosarcina acetivorans: MA_3696 Help Entry MA_3696           CDS       T00080                                  Name (GenBank) ribosomal protein S27a   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism mac  Methanosarcina acetivorans Pathway mac03010   Ribosome Brite KEGG Orthology (KO) [BR:mac00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     MA_3696   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     MA_3696  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mac03011]     MA_3696    04121 Ubiquitin system [BR:mac04121]     MA_3696   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mac04147]     MA_3696 Ribosome [BR:mac03011]  Ribosomal proteins   Eukaryotes    Small subunit     MA_3696   Archaea     MA_3696 Ubiquitin system [BR:mac04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    MA_3696 Exosome [BR:mac04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    MA_3696   Exosomal proteins of colorectal cancer cells    MA_3696 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Zn_ribbon_Nudix Ribosomal_L37e Rcat_RNF216 IBR_1 Zn_ribbon_RPB9 Zn_Ribbon_TF Cas12f1-like_TNB DUF6671 MqsA_antitoxin DUF1451 Zn_ribbon_IS1595 Zn_ribbon_NOB1 Motif Other DBs NCBI-ProteinID:  AAM07051 UniProt:  Q8TJT1 LinkDB All DBs Position 4551616..4551780 Genome browser AA seq 54 aa AA seqDB search MRCINMAVKDYYKVQGDSVTRLKQFCPRCGPGVFLADHKNRLACGKCGYTEFKK NT seq 165 nt NT seq  +upstreamnt  +downstreamnt ctgaggtgtataaacatggcagtaaaagattactataaagtccagggcgactccgtaacc agactcaaacagttctgtcccagatgcggacccggtgtattccttgccgaccacaaaaac cgccttgcctgcggaaagtgcggctacaccgaattcaagaaataa

DBGET integrated database retrieval system