Methanosarcina acetivorans: MA_3970 Help Entry MA_3970           CDS       T00080                                  Name (GenBank) ribosomal protein L40e   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism mac  Methanosarcina acetivorans Pathway mac03010   Ribosome Brite KEGG Orthology (KO) [BR:mac00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     MA_3970   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     MA_3970  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mac03011]     MA_3970    04121 Ubiquitin system [BR:mac04121]     MA_3970 Ribosome [BR:mac03011]  Ribosomal proteins   Eukaryotes    Large subunit     MA_3970   Archaea     MA_3970 Ubiquitin system [BR:mac04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    MA_3970 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_L40e Zn_Ribbon_1 DZR DZR_2 zf-AtTam37 Zn_ribbon_ZPR1 Zn_ribbon_RPAB4 Zn_ribbon_3 zf-ChsH2 DHHC Motif Other DBs NCBI-ProteinID:  AAM07320 UniProt:  Q8TJ19 LinkDB All DBs Position complement(4869298..4869456) Genome browser AA seq 52 aa AA seqDB search MTKMARFPEAEERLLNKKICMKCNARNAIRATRCRKCGYGTLRVKSKESKGA NT seq 159 nt NT seq  +upstreamnt  +downstreamnt gtgacaaaaatggctcgttttccagaagctgaagaaaggttacttaacaaaaaaatctgc atgaagtgtaatgccagaaacgccataagggcaacccgctgcagaaaatgcggctacggt actcttcgcgtgaaatccaaggaatccaagggagcatga

DBGET integrated database retrieval system