KEGG   Marinobacter sp. CA1: J2887_08080
Entry
J2887_08080       CDS       T10810                                 
Name
(GenBank) chemotaxis response regulator protein-glutamate methylesterase
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
maca  Marinobacter sp. CA1
Pathway
maca02020  Two-component system
maca02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:maca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    J2887_08080
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    J2887_08080
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:maca02022]
    J2887_08080
   02035 Bacterial motility proteins [BR:maca02035]
    J2887_08080
Enzymes [BR:maca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     J2887_08080
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     J2887_08080
Two-component system [BR:maca02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   J2887_08080
Bacterial motility proteins [BR:maca02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    J2887_08080
SSDB
Motif
Pfam: CheB_methylest Response_reg
Other DBs
NCBI-ProteinID: UDL06695
LinkDB
Position
1756485..1757621
AA seq 378 aa
MTVSVLVVDDSGFFRKRLTEILNASGNIKVVGVATNGREGVELAERLKPDVITMDYEMPV
LDGISAVKEIMKRRPTPVLMFSSLTYEGARVTLDALEAGAVDFLPKNFEEIARDTSQLQK
ILKDRILDVARSRPGARTAPAPEPARRPAPASPAARPSASASRPAPATPSRSQPEPAAPR
ASGKRTPSKHYNVVGIGTSTGGPIALQKVLMALPASFPAPLVLVQHMPASFTPAFADRLN
KLCQIEVRQAEDGDMLRPGVALLAPGGKQMMIENRGGQGRVRILPGDDRLNYKPCVDVTF
GSLARSFPGKTLGVILTGMGADGKEGCRLMKQSGSVIWSQDEKSSVIYGMPMAVAKAGLS
DEILSLEEVGPRLVEGVS
NT seq 1137 nt   +upstreamnt  +downstreamnt
atgacggtttctgttctggtcgttgatgactcagggtttttccgtaagcgactgactgaa
atcctcaatgcttccggtaacatcaaagtggtgggcgtggcgaccaacggtcgtgagggc
gtggagctggcagaacgcctgaagccggacgtcatcaccatggattacgagatgccggtg
ctggatggcatttcggcggtgaaagagatcatgaagcgccggccgacgccggtgctgatg
ttttcctcactgacctacgaaggtgcccgggtgaccctggatgcactggaagccggggcg
gtggattttctgcccaagaacttcgaggaaattgcccgcgataccagccagctccagaag
atcctcaaggatcgcattctggatgttgcccgcagccggcccggtgcccgcacggccccc
gcaccggagcctgcccgtcggcctgcgccggcctcacctgcggcccgcccgtcggcctcc
gcttcccgacctgcgcctgccactccatcacggagccagccggaaccggcggcaccccgg
gccagcggcaagcgcactcccagcaagcactacaacgtggtgggcatcggcacctcaacc
ggtggcccgattgccctgcaaaaggtattgatggcgttgccggcgagtttcccggcgccg
ctggtgctggttcagcacatgccggccagttttaccccggcctttgccgatcgcctcaac
aagctgtgccagattgaagtccgccaggccgaagacggcgacatgctgcgccccggtgtg
gcactgctggcgccgggcggcaaacagatgatgattgagaaccggggtgggcagggccgg
gtgcgaatcctgcccggtgacgatcgcctgaactacaaaccctgtgtggatgtgaccttt
ggttccctggcacgcagcttccccggcaagaccctgggggtcatcctcaccgggatgggc
gcggacggcaaggagggctgtcggttgatgaaacagagcggctcggtcatctggtcacag
gatgaaaagtcgtcagtgatctacggcatgcccatggcggtcgccaaggcgggcctgtcg
gatgagatcctttcactggaggaagttgggccccgcctggttgaaggtgtgagctga

DBGET integrated database retrieval system