KEGG   Mycobacterium adipatum: A7U43_07290
Entry
A7U43_07290       CDS       T09402                                 
Name
(GenBank) phosphonate ABC transporter ATP-binding protein
  KO
K02041  phosphonate transport system ATP-binding protein [EC:7.3.2.2]
Organism
madi  Mycobacterium adipatum
Pathway
madi02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:madi00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    A7U43_07290
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:madi02000]
    A7U43_07290
Enzymes [BR:madi01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.2  ABC-type phosphonate transporter
     A7U43_07290
Transporters [BR:madi02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphonate transporter
    A7U43_07290
SSDB
Motif
Pfam: ABC_tran AAA_21 AAA_29 nSTAND1 AAA_16 RsgA_GTPase AAA_22 SMC_N SbcC_Walker_B Rad17 AAA_33 AAA_18 AAA_23 nSTAND3 G-alpha ORC-CDC6-like
Other DBs
NCBI-ProteinID: ANE79155
UniProt: A0A172UJB7
LinkDB
Position
complement(1551863..1552714)
AA seq 283 aa
MSPAPRSARAEVSLPAGPGHPVAGDDLVVVARDVTKRFGDTLALDNVSLEVRRSELLVLL
GLSGSGKSTLLRCLNGLHAVSSGHVDVGGTRVEEASPAQLRALRTRVGFVFQHFNLVGRL
SCLENVLIGGLGQLRFPRYGALTYPRHMRMAALSHLDRVGLADLAERRADTLSGGQQQRV
AIARTLMQRPALLLADEPVASLDPENAGVVMDLLFQICVEEKLTVVCTLHQVDLALGWAH
RLVGLRNGRKVLDRPAVGLTRDEVMAIYQRVEPAGDAAAKQRS
NT seq 852 nt   +upstreamnt  +downstreamnt
atgtcaccggctccgagaagtgcaagggctgaggtgtcgctcccggccggtcccggccat
cccgtcgcgggcgacgacctggtcgtcgtcgcccgcgacgtcaccaaacgattcggtgac
accctcgcgttggacaacgtctcgctcgaggtgcggcgcagtgagctgctggtcctgctc
gggctgtccgggtcgggcaagtccacgctgctgcgctgcctcaacggactgcacgcggtc
agctccggccacgtcgacgtgggcggcacccgggtcgaggaggcctcgcctgcgcagctg
cgggcgctgcgcacccgggtggggttcgtgttccagcatttcaatctcgtggggcggctc
agttgtctggagaatgtcctcatcggcgggctcgggcagctcaggttcccgcgctacggc
gcgctgacgtacccgaggcacatgcggatggccgcgctgtcccatctcgaccgggtgggt
ctggccgacctcgccgaacgccgtgccgacaccctgtccggaggacagcaacagcgggtg
gcgatcgcccggacgctgatgcagcgtccggcgctgttgctggccgatgagccggtcgcc
tcgctcgatcccgagaacgccggcgtggtcatggatctgttgttccagatctgtgtcgag
gagaagctgaccgtggtgtgcaccctgcatcaggtcgacctcgcactgggctgggcgcat
cggctggtaggcctgcgcaatggccggaaagttctcgaccggccggccgtcggcctgacc
cgcgatgaggtgatggcgatctaccagcgggtcgagccggccggcgacgccgcggcaaag
caacgctcgtga

DBGET integrated database retrieval system