Mycobacterium adipatum: A7U43_23225 Help Entry A7U43_23225       CDS       T09402                                  Name (GenBank) hypothetical protein   KO K27095   acyl-CoA carboxylase epsilon subunit Organism madi  Mycobacterium adipatum Pathway madi00074   Mycolic acid biosynthesis madi00280   Valine, leucine and isoleucine degradation madi00630   Glyoxylate and dicarboxylate metabolism madi00640   Propanoate metabolism madi01100   Metabolic pathways madi01110   Biosynthesis of secondary metabolites madi01120   Microbial metabolism in diverse environments madi01200   Carbon metabolism Module madi_M00741   Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA madi_M00887   Mycolic acid biosynthesis, meromycolic acid + alpha-carboxyacyl-CoA + trehalose => TMM => TDM/mAGP/GMM Brite KEGG Orthology (KO) [BR:madi00001]  09100 Metabolism   09101 Carbohydrate metabolism    00630 Glyoxylate and dicarboxylate metabolism     A7U43_23225    00640 Propanoate metabolism     A7U43_23225   09103 Lipid metabolism    00074 Mycolic acid biosynthesis     A7U43_23225   09105 Amino acid metabolism    00280 Valine, leucine and isoleucine degradation     A7U43_23225 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACC_epsilon Motif Other DBs NCBI-ProteinID:  ANE81798 UniProt:  A0A172US43 LinkDB All DBs Position 4900354..4900641 Genome browser AA seq 95 aa AA seqDB search MSEANDSATVSEASEAPVEEGTAPGTHEPHIKVLKGSPTDAELAALIGVLSAAGGGPTEP VVTEKNLWGHPVDRLRYQSHSWQRVTLLERTHLRK NT seq 288 nt NT seq  +upstreamnt  +downstreamnt gtgagcgaagcgaacgattcagcgactgtgagcgaagcgagcgaggcccccgtggaagaa ggcaccgcaccgggcacccatgagccgcatatcaaggtgctcaagggttcccccaccgat gccgaactggccgccctgatcggggtgttgtcggccgccggcggcggtccgaccgagccg gtggtcaccgagaagaacctgtggggacatccggtggatcggctgcgctaccagagccac agctggcagcgggtgacgctgctggagcggacgcacctgcgcaagtga

DBGET integrated database retrieval system