Methanococcus aeolicus: Maeo_0284 Help Entry Maeo_0284         CDS       T00552                                  Name (GenBank) Ribosomal protein S27a   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism mae  Methanococcus aeolicus Pathway mae03010   Ribosome Brite KEGG Orthology (KO) [BR:mae00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     Maeo_0284   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     Maeo_0284  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mae03011]     Maeo_0284    04121 Ubiquitin system [BR:mae04121]     Maeo_0284   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mae04147]     Maeo_0284 Ribosome [BR:mae03011]  Ribosomal proteins   Eukaryotes    Small subunit     Maeo_0284   Archaea     Maeo_0284 Ubiquitin system [BR:mae04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    Maeo_0284 Exosome [BR:mae04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    Maeo_0284   Exosomal proteins of colorectal cancer cells    Maeo_0284 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 IBR_1 Rcat_RNF216 Cas12f1-like_TNB Zn_ribbon_RPB9 Ribosomal_L37e DUF2310 Zn_ribbon_IS1595 DUF1451 Motif Other DBs NCBI-ProteinID:  ABR55873 UniProt:  A6UTQ1 LinkDB All DBs Position 307730..307903 Genome browser AA seq 57 aa AA seqDB search MATKNKGTQKHNYYKVEGDKVEKLKKECPRCKGGVFMAEHLNRFACGKCGYTEFKKQ NT seq 174 nt NT seq  +upstreamnt  +downstreamnt atggctacaaaaaacaaaggaacacaaaaacacaattactacaaagttgaaggagacaaa gtagaaaaattaaaaaaagaatgcccaagatgtaaaggtggcgtattcatggctgagcac ctaaacagatttgcatgcggaaaatgtggatacacagaattcaaaaaacaataa

DBGET integrated database retrieval system