Mya arenaria (softshell): 128214326 Help Entry 128214326         CDS       T09995                                  Name (RefSeq) ras-related protein ced-10-like   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism maea  Mya arenaria (softshell) Pathway maea04145   Phagosome maea04148   Efferocytosis maea04310   Wnt signaling pathway maea04620   Toll-like receptor signaling pathway maea05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:maea00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     128214326  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     128214326    04148 Efferocytosis     128214326  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     128214326  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     128214326  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:maea04131]     128214326   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:maea04147]     128214326    04031 GTP-binding proteins [BR:maea04031]     128214326 Membrane trafficking [BR:maea04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     128214326  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     128214326   Macropinocytosis    Ras GTPases     128214326  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     128214326 Exosome [BR:maea04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    128214326   Exosomal proteins of other body fluids (saliva and urine)    128214326   Exosomal proteins of colorectal cancer cells    128214326   Exosomal proteins of bladder cancer cells    128214326 GTP-binding proteins [BR:maea04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     128214326 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf DAP3 MMR_HSR1 Motif Other DBs NCBI-GeneID:  128214326 NCBI-ProteinID:  XP_052776699 LinkDB All DBs Position 13:complement(52041411..52048282) Genome browser AA seq 203 aa AA seqDB search MENIKLVVVGDGGVGKSCLLIAYTTSAFPSKYVPTVFDNYSANIMVDGKAVNLGLWDTAG QEDYDRLRPLSYTGTDVFFICFDLSRPSSFENVEPIWLPEVRHYCPDIPIVLVGCKADLP SAVSAADIDKLTKTHGLKYCETSALTKKGLKNCFDEATRIALNAPKTKKSMGFFGKAKKT ITNPPVMPQTRTSLGVKAEKCEK NT seq 612 nt NT seq  +upstreamnt  +downstreamnt atggagaacataaaactagtagttgtcggcgacggcggcgtcggcaagagttgtcttctt atagcatacacaaccagcgcgttcccgtcgaagtacgtcccgacagtttttgacaattac tctgccaatataatggttgatgggaaagcggtcaatttgggcctctgggataccgccgga caggaggattacgaccgcctcagacccctttcctatacagggacggacgtgtttttcatc tgttttgaccttagcagaccatcttcatttgaaaacgtggagccaatatggctaccggaa gtgagacattactgcccagatataccgattgtacttgtcggatgcaaagctgacctgccg tccgcagtatccgcagccgacatcgacaagcttaccaagactcatggacttaaatactgt gaaaccagcgccctcaccaagaaaggactgaagaattgctttgatgaagcaacacggata gctctcaacgcaccaaagacaaagaaatccatgggttttttcggtaaagcgaaaaagacc atcacgaatccgccagttatgccgcagacacgtactagtctgggcgtcaaggcagaaaaa tgtgaaaaatga

DBGET integrated database retrieval system