Mya arenaria (softshell): 128232898 Help Entry 128232898         CDS       T09995                                  Name (RefSeq) elongin-B-like   KO K03873   elongin-B Organism maea  Mya arenaria (softshell) Pathway maea04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:maea00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     128232898  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:maea04121]     128232898    03400 DNA repair and recombination proteins [BR:maea03400]     128232898 Ubiquitin system [BR:maea04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      128232898    Cul5 complex      128232898 DNA repair and recombination proteins [BR:maea03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      128232898 SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Sporozoite_P67 LED_rpt Motif Other DBs NCBI-GeneID:  128232898 NCBI-ProteinID:  XP_052802654 LinkDB All DBs Position 4:complement(57432891..57440690) Genome browser AA seq 120 aa AA seqDB search MDVFLMIRRKKMTVFTDAKESTTVLEVKKIVEGIVKQKPEDQRLYKDEQPLDDNKSLGDC GFTSQTARAQAPATIGLAFKLEDGEFEPLEVTPLSSPPELPDVMKPQDSPSTHAQEQTAS NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atggatgtgtttttaatgatccggaggaagaaaatgacagttttcacagatgcaaaagaa tctacgacagtgttagaagtaaagaaaattgtagaaggcatagtgaaacaaaagccagag gatcagagactgtacaaagatgaacagccattagatgacaacaagtcgttgggtgactgc ggatttaccagccagacagcgagggcacaagcacctgcaactataggacttgcttttaag ctagaagatggagagtttgaacctttggaggtgaccccactatcgagtccaccagagctt cccgacgtgatgaagccccaggactcgccgtcgacacatgcacaggagcagactgcctca tag

DBGET integrated database retrieval system