Mya arenaria (softshell): 128245351 Help Entry 128245351         CDS       T09995                                  Name (RefSeq) centromere protein X-like   KO K15360   centromere protein X Organism maea  Mya arenaria (softshell) Pathway maea03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:maea00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     128245351  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:maea03400]     128245351 DNA repair and recombination proteins [BR:maea03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      128245351 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-X DUF5654 NNH2 CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  128245351 NCBI-ProteinID:  XP_052819450 LinkDB All DBs Position 2:complement(46600656..46610702) Genome browser AA seq 91 aa AA seqDB search MDVLTNVLFYCSPSTMAASFKQKTVQHILQQYFKDEKTKVNADALALLTEVISIFVAEAV GRTTKQAKKDGDDELTLEQFEKILPQLLLDF NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atggacgttttaactaatgttttgttttattgttcaccatcaactatggcggcctcattc aaacagaaaactgttcagcacattttacagcagtatttcaaagatgaaaagaccaaggtg aatgctgatgcattggctcttctcactgaagttatatccatttttgtggctgaggctgtg ggcagaacaactaaacaagcaaagaaagatggtgatgatgagttgacattggagcagttt gagaagatcctaccacaactgttgctggatttttag

DBGET integrated database retrieval system