Microvirgula aerodenitrificans: DAI18_09395 Help Entry DAI18_09395       CDS       T09834                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism maer  Microvirgula aerodenitrificans Pathway maer01100   Metabolic pathways maer01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:maer00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DAI18_09395    00074 Mycolic acid biosynthesis     DAI18_09395   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DAI18_09395 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AVY94231 UniProt:  A0A2S0PA32 LinkDB All DBs Position 1990571..1990828 Genome browser AA seq 85 aa AA seqDB search MNKQDIFDRLSATLQECFEIDAERIRPEARLKEDLDIDSIDAVDLIVKLRPLVGKRLHPE TFKSVRTLQDVVDALHTLMHAPDPS NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgaacaaacaggacattttcgaccgcctgtcggccaccctgcaggaatgttttgaaatc gatgccgagcgcatccggccggaagcccggctgaaggaagacctcgacatcgacagcatc gacgcggtcgacctgatcgtgaaattgcgcccgctggtcggcaagcgcctgcacccggaa accttcaagtcggtccgtacgctgcaggatgtcgtcgacgcgctgcacaccctgatgcac gcgccggacccgagctga

DBGET integrated database retrieval system