KEGG   Mycobacterium tuberculosis variant africanum: MAF_27980
Entry
MAF_27980         CDS       T01575                                 
Symbol
truB
Name
(GenBank) putative tRNA pseudouridine synthase B TRUB
  KO
K03177  tRNA pseudouridine55 synthase [EC:5.4.99.25]
Organism
maf  Mycobacterium tuberculosis variant africanum
Brite
KEGG Orthology (KO) [BR:maf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:maf03016]
    MAF_27980 (truB)
Enzymes [BR:maf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.25  tRNA pseudouridine55 synthase
     MAF_27980 (truB)
Transfer RNA biogenesis [BR:maf03016]
 Eukaryotic type
  tRNA modification factors
   Psudouridine synthases
    MAF_27980 (truB)
 Prokaryotic type
    MAF_27980 (truB)
SSDB
Motif
Pfam: TruB_N TruB_C TruB_C_2 DKCLD Peptidase_A21
Other DBs
NCBI-ProteinID: CCC27868
LinkDB
Position
complement(3078931..3079827)
AA seq 298 aa
MSATGPGIVVIDKPAGMTSHDVVGRCRRIFATRRVGHAGTLDPMATGVLVIGIERATKIL
GLLTAAPKSYAATIRLGQTTSTEDAEGQVLQSVPAKHLTIEAIDAAMERLRGEIRQVPSS
VSAIKVGGRRAYRLARQGRSVQLEARPIRIDRFELLAARRRDQLIDIDVEIDCSSGTYIR
ALARDLGDALGVGGHVTALRRTRVGRFELDQARSLDDLAERPALSLSLDEACLLMFARRD
LTAAEASAAANGRSLPAVGIDGVYAACDADGRVIALLRDEGSRTRSVAVLRPATMHPG
NT seq 897 nt   +upstreamnt  +downstreamnt
atgagcgcaaccggccccggaatcgtggttatcgacaagcccgcgggaatgaccagccat
gacgtggtggggcggtgccgccgcatcttcgccacccggcgggtcggccacgcgggcacc
ctggacccgatggccaccggggtgttggtgatcggcatcgaacgcgccaccaagatcctc
ggtctgctgacggcggcccccaagtcgtatgccgccaccatccgcttgggtcagaccact
tccaccgaggacgccgaaggtcaagtgctgcagtcggttccggctaagcacctgaccatc
gaggcgatcgacgccgcgatggagcggctgcgcggtgagatccggcaggtgccgtcgtcg
gtcagcgcgatcaaggtcggtggccgacgcgcctatcggttggcccgccaggggcgctcc
gtgcaattggaagcccggccgatccgcatcgaccggttcgagctgctggccgcacgccgg
cgcgaccagctcatcgatatcgatgtggagatcgactgctcctcgggaacctacatccgc
gcgttggcacgcgacctcggcgacgcgcttggggtgggaggccatgtgacggcgttgcgg
cgcacccgcgtcggccgcttcgagctggaccaggcgagatcgctcgacgatctcgcggag
cgccccgcgctgagcctgagcctcgatgaggcctgcctgctgatgtttgcgcgccgcgac
ctgaccgccgcggaggccagcgcggccgccaacggccggtccctgccggcggtcggtatc
gacggcgtgtacgcggcctgtgacgccgacggccgggttatcgcgctgctgcgtgacgag
ggttcgcggaccaggtcggtggcggtgctccgcccggcgacgatgcaccccgggtag

DBGET integrated database retrieval system