KEGG   Paramagnetospirillum magneticum: amb3714
Entry
amb3714           CDS       T00305                                 
Name
(GenBank) Predicted permease
  KO
K07091  lipopolysaccharide export system permease protein
Organism
mag  Paramagnetospirillum magneticum
Pathway
mag02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:mag00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    amb3714
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mag02000]
    amb3714
Transporters [BR:mag02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Lipopolysaccharide transporter
    amb3714
SSDB
Motif
Pfam: LptF_LptG
Other DBs
NCBI-ProteinID: BAE52518
UniProt: Q2W0V7
LinkDB
Position
4082034..4083140
AA seq 368 aa
MMRQMLVGMIFVSAALACVLWLTQSLRFVEMIVNKGLSIGAFLKLTILLMPGFLVVIIPI
SLFAVVLFTYNRLIADRELVVLRAAGLSHLALARPAVILGLAVSAVGYMLSCWIIPVTVR
SFHEMQWTIRNDIGNVLLQEGMFNKFGEGLTIYVRSRTPNGELTGLLVHDKRHAQRPVTL
MAERGALVYTEQGPRVLMVNGNRQEVTPGTGKLSLLYFDNYTVDFNTATGAKHDRVRDAR
ERSTLELLAIDSSMENKGELRRFKSELHSRLTSPLYSLGFPLLAAAVLLTSGFDRRGQTA
QVITATALMVAVQALALGASNLSSGNLAFVPLIYINAALPIALGLWVLARPPWPRRRTNA
ASGTATAT
NT seq 1107 nt   +upstreamnt  +downstreamnt
atgatgcgccagatgctggtggggatgatcttcgtctccgccgcgctggcctgtgtcctg
tggctgacccagtcgttgcgcttcgtcgagatgatcgtcaacaaggggctgtccatcggc
gccttcctgaagctgaccatcctgctgatgccgggcttcctggtggtgatcatcccgatt
tcccttttcgccgtagtgcttttcacctacaaccgcttgattgcggaccgggaactggtg
gttctgcgcgctgcggggctcagccatctggccctggcgcggccggcggtcattctcggc
ctggcggtcagtgccgtgggctacatgctcagttgctggatcattccggtcaccgtgcgc
agcttccacgagatgcagtggaccatccgcaacgacatcggcaacgtgttgctgcaggaa
ggcatgttcaacaagttcggcgagggcttgaccatctacgtccgctcgcgcacccccaac
ggcgaactcaccggcctgctggtccatgacaagcgccatgcccagcgcccggtcaccctg
atggccgagcgcggcgccctggtctataccgagcagggtccccgcgtgctgatggtcaac
ggcaatcgccaggaagtgacccccggcaccggcaagctgtcgctgctgtatttcgacaat
tacaccgtggacttcaacaccgccaccggcgccaagcacgaccgggtccgtgatgcccgc
gaacgctcgacgctggaactgctggccatcgacagcagcatggagaacaagggggagttg
cgccggttcaagtccgagctgcattcccgcctgacctcgccgctgtacagcctgggcttt
cccctgctggccgccgcggtcctgctgacctcgggcttcgaccggcggggccagaccgcc
caggtgatcaccgccacggccctgatggtggcggttcaggcgctggcgcttggcgcctcc
aacctgtcgtcgggcaatctggccttcgtgccgctcatctacatcaatgcagcccttccc
atcgccctcggcctctgggtcctggcgcgcccgccgtggccgcgtcgccggaccaatgcg
gcctccggcacggctacggcgacatag

DBGET integrated database retrieval system