Magnetospirillum sp. ME-1: WV31_11150 Help Entry WV31_11150        CDS       T04817                                  Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism magn  Magnetospirillum sp. ME-1 Brite KEGG Orthology (KO) [BR:magn00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:magn03032]     WV31_11150    03036 Chromosome and associated proteins [BR:magn03036]     WV31_11150    03400 DNA repair and recombination proteins [BR:magn03400]     WV31_11150 DNA replication proteins [BR:magn03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     WV31_11150 Chromosome and associated proteins [BR:magn03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     WV31_11150 DNA repair and recombination proteins [BR:magn03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       WV31_11150 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG DUF2267 HU-CCDC81_euk_1 HU-CCDC81_bac_2 HU-CCDC81_euk_2 Motif Other DBs NCBI-ProteinID:  ARJ66177 UniProt:  A0A1W6CMV6 LinkDB All DBs Position complement(2405682..2405960) Genome browser AA seq 92 aa AA seqDB search MNKSELVNAVADSANMTKADAGNAIDAVFAAITTAMKSGDDVRLVGFGTFSVSARPAREG RNPQTGKTLTIAASKSAKFTAGKTLKDTINGR NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaacaagtccgaattggtcaacgccgtcgccgatagtgccaacatgaccaaggccgac gcgggcaatgctattgacgctgtttttgcagccatcactaccgccatgaagtccggcgat gatgtgcgtctggttggctttggaactttctcggtttctgcccgtcctgcacgtgaaggc aggaatccgcaaactggcaagaccctcaccatcgcggccagcaagtctgccaaattcacc gccggaaagaccctcaaggacaccatcaatggccgatga

DBGET integrated database retrieval system