Magnetospirillum sp. XM-1: XM1_1030 Help Entry XM1_1030          CDS       T04231                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism magx  Magnetospirillum sp. XM-1 Pathway magx00998   Biosynthesis of various antibiotics magx01100   Metabolic pathways magx01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:magx00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     XM1_1030    00074 Mycolic acid biosynthesis     XM1_1030   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     XM1_1030 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  CUW38099 UniProt:  A0A0U5MAK8 LinkDB All DBs Position I:complement(991780..992013) Genome browser AA seq 77 aa AA seqDB search MNIYERLTPIFQDVFDNDDVIATPTLTAAEVEGWDSLSHIRLVVAVESEFGIKFSISELT GLKNVGAMVALIEAKTS NT seq 234 nt NT seq  +upstreamnt  +downstreamnt gtgaatatttacgagaggttgacaccgatcttccaggatgtgttcgacaatgacgacgtg atcgccacccccacgctgaccgccgccgaggtcgagggctgggactccttatcgcatatc cgcctagtggtcgccgtcgagtccgagttcggaatcaagttcagtatctctgagctgacc ggcctcaagaatgtgggcgccatggtggccttgatcgaggcgaagacctcctga

DBGET integrated database retrieval system