Magnetospirillum sp. XM-1: XM1_2865 Help Entry XM1_2865          CDS       T04231                                  Symbol acpP Name (GenBank) acyl carrier protein (ACP)   KO K02078   acyl carrier protein Organism magx  Magnetospirillum sp. XM-1 Pathway magx00998   Biosynthesis of various antibiotics magx01100   Metabolic pathways magx01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:magx00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     XM1_2865 (acpP)    00074 Mycolic acid biosynthesis     XM1_2865 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     XM1_2865 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1493 DUF5783 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  CUW39934 UniProt:  A0A0U5MEB1 LinkDB All DBs Position I:2859905..2860138 Genome browser AA seq 77 aa AA seqDB search MSDVAERVKKIVVEHLGVEEAKVTENASFIDDLGADSLDTVELVMAFEEEFSVEIPDDAA EKILTVKDAIDFITANS NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagtgacgtggctgaacgggttaagaagatcgtcgtcgagcatctgggcgtcgaagag gccaaggtgaccgagaacgcctccttcatcgatgacctgggcgccgacagcctcgacacc gtcgagctggtgatggccttcgaagaagaattctccgtcgagatccccgatgacgccgcc gagaagattctcacggtgaaggacgccatcgatttcatcacggcgaattcctaa

DBGET integrated database retrieval system