Methylotuvimicrobium alcaliphilum: MEALZ_3633 Help Entry MEALZ_3633        CDS       T01649                                  Symbol acpP Name (GenBank) Acyl carrier protein 2   KO K02078   acyl carrier protein Organism mah  Methylotuvimicrobium alcaliphilum Pathway mah01100   Metabolic pathways mah01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mah00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MEALZ_3633 (acpP)    00074 Mycolic acid biosynthesis     MEALZ_3633 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MEALZ_3633 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding CagD AAA_lid_6 PP-binding_2 Motif Other DBs NCBI-ProteinID:  CCE25291 UniProt:  G4SXC7 LinkDB All DBs Position complement(4198154..4198402) Genome browser AA seq 82 aa AA seqDB search MNDRDDILQMIREIMQEMFEIDADDVTPEARLYEDLDFDSIDAVDMIVKLKELTGKAVKP EDFKNARTVGDVVEAVDKLIHI NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgaacgatcgcgatgacattctgcaaatgatcagggaaatcatgcaggagatgttcgag atagacgcggacgacgtgacgccggaggcccgtctttatgaagacctcgatttcgacagc atcgatgcggtcgatatgatcgtcaaactcaaggagttgaccggcaaggccgtgaagccg gaagattttaagaacgcacgcaccgtaggcgatgtcgtcgaagccgtcgataaactgatc catatctaa

DBGET integrated database retrieval system