Metarhizium robertsii: MAA_02710 Help Entry MAA_02710         CDS       T03107                                  Name (RefSeq) UDP-glucose 4-epimerase Gal10   KO K03016   DNA-directed RNA polymerases I, II, and III subunit RPABC3 Organism maj  Metarhizium robertsii Pathway maj03020   RNA polymerase maj03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:maj00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     MAA_02710   09124 Replication and repair    03420 Nucleotide excision repair     MAA_02710  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:maj03021]     MAA_02710    03400 DNA repair and recombination proteins [BR:maj03400]     MAA_02710 Transcription machinery [BR:maj03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      MAA_02710   RNA polymerase III system    RNA polymerase III      MAA_02710   RNA polymerase I system    RNA polymerase I      MAA_02710 DNA repair and recombination proteins [BR:maj03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       MAA_02710 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_Rpb8 RNA_pol_RpbG Motif Other DBs NCBI-GeneID:  19256996 NCBI-ProteinID:  XP_007818899 UniProt:  E9ERW4 LinkDB All DBs AA seq 150 aa AA seqDB search MSGGGGDATLFEESFTVTEYDQSKYDRVARISCTSADSQTVMVLDINIELFPCARSDSLH VVLSTTLSPDGSKEDDKGWRDVGKGGDAPATLADLYDYVCYGKIYKFEETYDGNTINAYV SFGGLLMSLQGPVKKLTPLRVDNVYLLIKK NT seq 453 nt NT seq  +upstreamnt  +downstreamnt atgtccggcggcggtggcgacgcaaccctgtttgaggagagctttacggtcaccgaatat gatcaatccaaatacgatcgtgttgcccgcatttcctgtacatcggccgactcgcaaact gtgatggtgcttgatatcaacatcgaactcttcccttgcgcaaggtccgattccctacat gttgtcctatccacaacattatcaccagacggcagcaaggaggacgataagggttggcga gatgtcggcaagggaggggacgccccagctacgttggctgatttgtacgactatgtttgc tatggcaaaatttacaaatttgaagagacatatgatggcaataccatcaatgcatacgta tcatttggaggcctcctcatgtccttgcaaggacccgttaaaaagctcacgcctctacga gttgacaacgtctatcttttgatcaagaagtaa

DBGET integrated database retrieval system