Metarhizium robertsii: MAA_04310 Help Entry MAA_04310         CDS       T03107                                  Name (RefSeq) nucleosome binding protein   KO K27246   non-histone chromosomal protein 6 Organism maj  Metarhizium robertsii Brite KEGG Orthology (KO) [BR:maj00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:maj03036]     MAA_04310 Chromosome and associated proteins [BR:maj03036]  Eukaryotic type   Nucleosome assembly factors    Histone chaperones     FACT complex      MAA_04310 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  HMG_box HMG_box_2 Ccdc124 HMG_box_5 Motif Other DBs NCBI-GeneID:  19258596 NCBI-ProteinID:  XP_007820499 UniProt:  E9EWB1 LinkDB All DBs AA seq 92 aa AA seqDB search MPKVKRGKKDDGKKKRGPKRGLSAYMFFANEQRENVRAENPNITFGQVGKVLGERWKALN DKQRAPYEAKAAADKKRYEDEKAAFQAEDDSN NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgcctaaggttaagcgcggcaagaaggacgatggcaagaagaagcgcggccccaagcgt ggtctctctgcttacatgttcttcgccaatgagcagcgcgagaacgtccgtgctgagaac cccaacatcaccttcggccaggttggcaaggttcttggtgagcgctggaaggccttgaac gacaagcagcgtgctccttacgaagccaaggctgctgccgacaagaaacggtatgaggac gagaaggccgctttccaggccgaggatgactctaactaa

DBGET integrated database retrieval system