Monopterus albus (swamp eel): 109951504 Help Entry 109951504         CDS       T05607                                  Name (RefSeq) protein S100-A1-like   KO K17274   protein S100-A10 Organism malb  Monopterus albus (swamp eel) Pathway malb04382   Cornified envelope formation malb05132   Salmonella infection Brite KEGG Orthology (KO) [BR:malb00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     109951504  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     109951504  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:malb04147]     109951504 Exosome [BR:malb04147]  Exosomal proteins   Exosomal proteins of microglial cells    109951504 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EF-hand_5 EF-hand_6 EF-hand_8 SPARC_Ca_bdg EH DEK_C EF-hand_11 Motif Other DBs NCBI-GeneID:  109951504 NCBI-ProteinID:  XP_020441688 UniProt:  A0A3Q3JR66 LinkDB All DBs Position Unknown AA seq 102 aa AA seqDB search MPSELECAMQSLITVFYRYAGKDKDKDTSTLSRRELRELMENELSTFLKSQKDPAAVDKI MKDLDANGDGRVDFEEFVSLIVGLSIACEQCYKMHMKKMGKN NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atgccttcagaactggaatgtgccatgcagtcactcatcacagtgttctaccgttatgcc gggaaggacaaggacaaggacacgagcacactcagccggcgagagctcagagagttgatg gagaatgagctgtctacattccttaagtctcagaaggatcctgctgctgtagacaagata atgaaggacctggatgccaacggagatggtcgagtggactttgaggagtttgtttctctg attgtgggactttccattgcctgtgagcagtgctataagatgcacatgaagaagatggga aagaactga

DBGET integrated database retrieval system