Monopterus albus (swamp eel): 109952337 Help Entry 109952337         CDS       T05607                                  Name (RefSeq) insulin-like   KO K04526   insulin Organism malb  Monopterus albus (swamp eel) Pathway malb04010   MAPK signaling pathway malb04068   FoxO signaling pathway malb04081   Hormone signaling malb04114   Oocyte meiosis malb04140   Autophagy - animal malb04150   mTOR signaling pathway malb04810   Regulation of actin cytoskeleton malb04910   Insulin signaling pathway malb04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:malb00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     109952337    04068 FoxO signaling pathway     109952337    04150 mTOR signaling pathway     109952337   09133 Signaling molecules and interaction    04081 Hormone signaling     109952337  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     109952337   09143 Cell growth and death    04114 Oocyte meiosis     109952337   09142 Cell motility    04810 Regulation of actin cytoskeleton     109952337  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     109952337    04914 Progesterone-mediated oocyte maturation     109952337  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:malb04052]     109952337 Cytokines and neuropeptides [BR:malb04052]  Neuropeptides   Unclassified    109952337 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  109952337 NCBI-ProteinID:  XP_020443020 UniProt:  A0A3Q3KDW5 LinkDB All DBs Position Unknown AA seq 115 aa AA seqDB search MAALWLQSVSLLVLLIVSWPGSQALSPPHHWCGSHLVEALYRVCGDSGFYNTKRDIDPLL SFLFPEVGRTTAAGGENEVAEFTFKDQMVTMVKRGIVEECCLNPCTTSVLKNYCN NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atggcagcactgtggctccagtctgtctctctgctggtcttactgatcgtgtcgtggccg ggctcccaggccctcagccccccgcaccactggtgcggctctcacctggtcgaggccctc tacagagtctgtggggacagtggcttctacaacactaagagagacattgaccctctgctg agtttcctgttcccagaggtgggcagaactacagcagcgggtggagagaacgaggtggct gaattcaccttcaaggaccagatggtgacaatggtgaagcgaggcattgtggaggagtgc tgtctgaatccatgcaccacgtcagtcctgaagaactactgcaactga

DBGET integrated database retrieval system