Monopterus albus (swamp eel): 109959712 Help Entry 109959712         CDS       T05607                                  Name (RefSeq) C-X-C motif chemokine 5-like   KO K12671   C-X-C motif chemokine 10 Organism malb  Monopterus albus (swamp eel) Pathway malb04060   Cytokine-cytokine receptor interaction malb04620   Toll-like receptor signaling pathway malb04622   RIG-I-like receptor signaling pathway malb04623   Cytosolic DNA-sensing pathway Brite KEGG Orthology (KO) [BR:malb00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     109959712  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     109959712    04622 RIG-I-like receptor signaling pathway     109959712    04623 Cytosolic DNA-sensing pathway     109959712  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:malb04052]     109959712    00536 Glycosaminoglycan binding proteins [BR:malb00536]     109959712 Cytokines and neuropeptides [BR:malb04052]  Cytokines   Chemokines    109959712 Glycosaminoglycan binding proteins [BR:malb00536]  Heparan sulfate / Heparin   Chemokines    109959712 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 JAG1-like_EGF2 Motif Other DBs NCBI-GeneID:  109959712 NCBI-ProteinID:  XP_020454953 UniProt:  A0A4D6FRX4 LinkDB All DBs Position Unknown AA seq 95 aa AA seqDB search MNSHAIAFVTCLLVLCAEGQLANRARQCKCLNGYIGRINPQLIKAKPVIHHPSIFCPNTE IIITTKTNKEKCVDPESLLGKLILKTTTGSARKQL NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgaattcacatgccatcgcctttgtcacctgcttgcttgtcctctgtgcagaaggacaa ctagccaacagagctagacagtgcaaatgcttgaacggttacattggcaggatcaaccca cagctcatcaaggcaaagccagtcatacaccacccaagtatcttctgtccaaacacagag attattattactacaaaaacaaataaagaaaaatgtgtggatcctgagtcactgcttgga aaactcattctgaaaacaacaacaggctcagcaagaaagcagctgtga

DBGET integrated database retrieval system