Monopterus albus (swamp eel): 109960080 Help Entry 109960080         CDS       T05607                                  Name (RefSeq) cystatin-B-like   KO K13907   cystatin-A/B Organism malb  Monopterus albus (swamp eel) Brite KEGG Orthology (KO) [BR:malb00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:malb01002]     109960080   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:malb04147]     109960080 Peptidases and inhibitors [BR:malb01002]  Peptidase inhibitors   Family I25: cystatin family    109960080 Exosome [BR:malb04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    109960080 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cystatin NA37 Motif Other DBs NCBI-GeneID:  109960080 NCBI-ProteinID:  XP_020455589 UniProt:  A0A3Q3KCY4 LinkDB All DBs Position Unknown AA seq 100 aa AA seqDB search MSGMCGGLSASKPADEEIQKLCDSVKSLAEAKSGKNYGVFNAISYTSQIVAGTNYFVKVN IGGDGYIHLRIYKKLPCYGGDLELTAIQEPKTLHDPIVYF NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgtcgggcatgtgtggaggcctttccgcgtcgaagcctgctgacgaagaaattcagaag ctatgcgacagcgtaaaatcccttgcagaggcaaaatccgggaaaaactatggtgtcttt aacgccataagctacacgtcgcagattgtggccgggaccaactacttcgtaaaggtcaac attggaggagatggttatattcaccttcgtatttacaaaaaactcccatgttatgggggg gatcttgaattgacggctattcaagaacccaagaccctgcatgaccctattgtgtacttc taa

DBGET integrated database retrieval system