Monopterus albus (swamp eel): 109968176 Help Entry 109968176         CDS       T05607                                  Symbol npy Name (RefSeq) pro-neuropeptide Y   KO K05232   neuropeptide Y Organism malb  Monopterus albus (swamp eel) Pathway malb04080   Neuroactive ligand-receptor interaction malb04920   Adipocytokine signaling pathway Brite KEGG Orthology (KO) [BR:malb00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     109968176 (npy)  09150 Organismal Systems   09152 Endocrine system    04920 Adipocytokine signaling pathway     109968176 (npy)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:malb04052]     109968176 (npy) Cytokines and neuropeptides [BR:malb04052]  Neuropeptides   GPCR binding    109968176 (npy) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Hormone_3 Motif Other DBs NCBI-GeneID:  109968176 NCBI-ProteinID:  XP_020469903 LinkDB All DBs Position Unknown AA seq 99 aa AA seqDB search MHPNLVSWLGTLGFLLWALLCLGALTEGYPVKPENPGEDAPAVELAKYYSALRHYINLIT RQRYGKRSSSEFLDTLITELLMKESTDTLPQSRYDPSLW NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgcatcctaacttggtgagctggctggggaccctggggttcctgctgtgggcgctgctc tgcctgggcgccctgacagagggatacccggtaaaaccggagaaccccggggaggacgcc ccagcggtggagctggccaagtactactcagccctgagacactacatcaacctcatcaca aggcagaggtatgggaaaaggtccagttctgagttcctggacacactgatcacagagctg ttgatgaaggaaagcacagacacacttccacagtcaagatatgacccatcattgtggtga

DBGET integrated database retrieval system