Monopterus albus (swamp eel): 109968557 Help Entry 109968557         CDS       T05607                                  Symbol mras Name (RefSeq) ras-related protein M-Ras   KO K07831   Ras-related protein M-Ras Organism malb  Monopterus albus (swamp eel) Pathway malb04010   MAPK signaling pathway malb04137   Mitophagy - animal malb04140   Autophagy - animal malb04218   Cellular senescence malb04371   Apelin signaling pathway malb04519   Cadherin signaling malb04625   C-type lectin receptor signaling pathway malb04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:malb00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     109968557 (mras)    04371 Apelin signaling pathway     109968557 (mras)   09133 Signaling molecules and interaction    04519 Cadherin signaling     109968557 (mras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     109968557 (mras)    04137 Mitophagy - animal     109968557 (mras)   09143 Cell growth and death    04218 Cellular senescence     109968557 (mras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     109968557 (mras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     109968557 (mras)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:malb04031]     109968557 (mras) GTP-binding proteins [BR:malb04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     109968557 (mras) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf RsgA_GTPase MMR_HSR1 ATP_bind_1 AAA_16 Motif Other DBs NCBI-GeneID:  109968557 NCBI-ProteinID:  XP_020470561 LinkDB All DBs Position Unknown AA seq 208 aa AA seqDB search MATSAVPSDNLPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDGQW AILDVLDTAGQEEFSAMREQYMRTGDGFLIVFSVTDKASFEHVDRFHQLILRVKDREAFP MVLVANKVDLVHLRKVITDQGQEMAAKHNITYIETSAKDPPMNVDKAFHELVRVIRQQVP ERNQKKKKKMKWRAERSTGSHRFHCAIL NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atggcgaccagcgctgtgccaagtgacaacctgccaacatacaagctggtggtggtgggg gatggtggtgttgggaagagtgccctcaccatccagtttttccagaagatttttgtgcca gactatgatcccacgatcgaggactcgtatctgaaacatacagagatagacgggcagtgg gcaatactggatgtgctggacacagcaggccaagaggagttcagtgcaatgagggagcag tatatgaggacaggagacggcttccttatcgtcttctctgtgacagacaaggccagcttt gaacacgttgaccgatttcatcaactcatactacgggtcaaagacagggaggccttcccc atggtgctggttgcaaacaaagtggacttggtccacctgagaaaggtcataacagaccag ggccaagagatggctgcaaaacataatataacttacattgaaaccagtgccaaggatcca ccaatgaatgtggacaaagcttttcatgagctagtgcgtgttataagacaacaggtccca gagcgaaaccagaagaagaaaaagaagatgaaatggagagcagaacgttccacaggttcc cacaggttccactgcgccatattgtga

DBGET integrated database retrieval system