Monopterus albus (swamp eel): 109970774 Help Entry 109970774         CDS       T05607                                  Symbol hras Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism malb  Monopterus albus (swamp eel) Pathway malb04010   MAPK signaling pathway malb04012   ErbB signaling pathway malb04068   FoxO signaling pathway malb04137   Mitophagy - animal malb04140   Autophagy - animal malb04144   Endocytosis malb04150   mTOR signaling pathway malb04210   Apoptosis malb04218   Cellular senescence malb04370   VEGF signaling pathway malb04371   Apelin signaling pathway malb04510   Focal adhesion malb04540   Gap junction malb04625   C-type lectin receptor signaling pathway malb04810   Regulation of actin cytoskeleton malb04910   Insulin signaling pathway malb04912   GnRH signaling pathway malb04916   Melanogenesis malb05132   Salmonella infection Brite KEGG Orthology (KO) [BR:malb00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     109970774 (hras)    04012 ErbB signaling pathway     109970774 (hras)    04370 VEGF signaling pathway     109970774 (hras)    04371 Apelin signaling pathway     109970774 (hras)    04068 FoxO signaling pathway     109970774 (hras)    04150 mTOR signaling pathway     109970774 (hras)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     109970774 (hras)    04140 Autophagy - animal     109970774 (hras)    04137 Mitophagy - animal     109970774 (hras)   09143 Cell growth and death    04210 Apoptosis     109970774 (hras)    04218 Cellular senescence     109970774 (hras)   09144 Cellular community - eukaryotes    04510 Focal adhesion     109970774 (hras)    04540 Gap junction     109970774 (hras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     109970774 (hras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     109970774 (hras)   09152 Endocrine system    04910 Insulin signaling pathway     109970774 (hras)    04912 GnRH signaling pathway     109970774 (hras)    04916 Melanogenesis     109970774 (hras)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     109970774 (hras)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:malb04131]     109970774 (hras)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:malb04147]     109970774 (hras)    04031 GTP-binding proteins [BR:malb04031]     109970774 (hras) Membrane trafficking [BR:malb04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     109970774 (hras)  Endocytosis   Macropinocytosis    Ras GTPases     109970774 (hras) Exosome [BR:malb04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    109970774 (hras)   Exosomal proteins of colorectal cancer cells    109970774 (hras) GTP-binding proteins [BR:malb04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     109970774 (hras) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin DUF6974 Ldh_1_N Motif Other DBs NCBI-GeneID:  109970774 NCBI-ProteinID:  XP_020474229 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVDTRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGQD CMSCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggagtataagctggtggtggtgggagctggaggcgtgggcaagagtgcactcacc atccagctcatccagaaccactttgtggatgaatatgaccccaccatagaggattcatac aggaaacaagttgtgattgatggggagacctgcctgctggacatcttggacactgcaggt caggaggagtacagcgccatgagggaccagtacatgaggacaggggagggcttcctctgt gtcttcgccatcaacaacaccaagtcctttgaggacattcaccagtacagagaacagatt aaacgtgtaaaggactcagatgatgttcccatggtgcttgtgggcaacaaatgtgacctc ccagcacgtacagtggacacaagacaagcccaggaactcgctcgctcctatggcatccca tatatcgagacctctgctaagacacgacagggagtagaagatgccttctacacgctggtt agggagatcagacagcataagttgaggaagctgaacccacctgacgagagtggtcaggac tgtatgagctgtcgctgtgtggtgtcgtga

DBGET integrated database retrieval system