Monopterus albus (swamp eel): 109971079 Help Entry 109971079         CDS       T05607                                  Symbol cd59 Name (RefSeq) CD59 glycoprotein   KO K04008   CD59 antigen Organism malb  Monopterus albus (swamp eel) Brite KEGG Orthology (KO) [BR:malb00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:malb04147]     109971079 (cd59)    04090 CD molecules [BR:malb04090]     109971079 (cd59)    00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:malb00537]     109971079 (cd59) Exosome [BR:malb04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    109971079 (cd59)   Exosomal proteins of other body fluids (saliva and urine)    109971079 (cd59)   Exosomal proteins of colorectal cancer cells    109971079 (cd59) CD molecules [BR:malb04090]  Proteins   109971079 (cd59) Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:malb00537]  Antigens   109971079 (cd59) SSDB OrthologParalogGFIT Motif Pfam:  CD59 Toxin_TOLIP UPAR_LY6 Motif Other DBs NCBI-GeneID:  109971079 NCBI-ProteinID:  XP_020474764 UniProt:  A0A3Q3IEI6 LinkDB All DBs Position Unknown AA seq 117 aa AA seqDB search MKRSLGICLLICSALIGLGSAIRCYSCKDYTGSCSKERDCSYDDACLTLYERGGMTYRQC MKYSDCDYGRLGQMFPQVSSFTFKCCNSDLCNSAPSSAMSSLIGLLASVLVMWWCLQ NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atgaagcgctccctggggatctgtttgctgatctgctctgccctgattggacttggatca gccatccgatgttacagctgtaaggattacacaggcagctgtagcaaagaacgagactgt agttatgacgacgcctgcctcacgctctatgagagaggtgggatgacctatcgccaatgt atgaagtattcagactgcgactatggacggctgggccagatgttcccccaggtgtccagt ttcaccttcaagtgctgcaactcagacctatgtaactccgccccttcatctgcaatgagt tctctgattggtctgctggcctctgtgctggtcatgtggtggtgcctccaatga

DBGET integrated database retrieval system