Monopterus albus (swamp eel): 109971437 Help Entry 109971437         CDS       T05607                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism malb  Monopterus albus (swamp eel) Pathway malb04060   Cytokine-cytokine receptor interaction malb04218   Cellular senescence malb04620   Toll-like receptor signaling pathway malb04621   NOD-like receptor signaling pathway malb04622   RIG-I-like receptor signaling pathway malb05132   Salmonella infection Brite KEGG Orthology (KO) [BR:malb00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     109971437  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     109971437  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     109971437    04621 NOD-like receptor signaling pathway     109971437    04622 RIG-I-like receptor signaling pathway     109971437  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     109971437  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:malb04052]     109971437    00536 Glycosaminoglycan binding proteins [BR:malb00536]     109971437 Cytokines and neuropeptides [BR:malb04052]  Cytokines   Chemokines    109971437 Glycosaminoglycan binding proteins [BR:malb00536]  Heparan sulfate / Heparin   Chemokines    109971437 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  109971437 NCBI-ProteinID:  XP_020475347 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MKLCILLVFGALVVIIKGMPPISRDYNTHCQCLQVESRIIPPDSLRSIKLIPEGPHCPET EVIAGLGNGLKVCLNPQSSWVKKLIHFVLEKQLHQQGKALPKSQA NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgaagctctgcatcctgcttgtgtttggggccctggttgtcatcattaagggcatgcca ccaatcagcagggactacaacacacactgtcagtgcctgcaggtggagtccaggatcatt cctccagacagtctgaggagcatcaagctcatccctgaagggcctcactgcccagaaaca gaggtcatagctggactggggaacgggctgaaggtgtgtctgaatcctcagtcgtcctgg gtgaagaaactgatccactttgttcttgagaaacaattacatcagcaaggaaaagcgctt cccaagagtcaagcataa

DBGET integrated database retrieval system