Monopterus albus (swamp eel): 109971801 Help Entry 109971801         CDS       T05607                                  Symbol dpy30 Name (RefSeq) protein dpy-30 homolog   KO K14965   protein dpy-30 Organism malb  Monopterus albus (swamp eel) Brite KEGG Orthology (KO) [BR:malb00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:malb03036]     109971801 (dpy30) Chromosome and associated proteins [BR:malb03036]  Eukaryotic type   Histone modification proteins    HMT complexes     COMPASS/SET1 complex      109971801 (dpy30)     MLL-HCF complex      109971801 (dpy30)     MLL3/MLL4 complex      109971801 (dpy30) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dpy-30 Motif Other DBs NCBI-GeneID:  109971801 NCBI-ProteinID:  XP_020475940 LinkDB All DBs Position Unknown AA seq 85 aa AA seqDB search MADDHTDADQSMEGHTPVSENPHAEYGLTDNIQRTVENEKASAEKISKQKVDLQALPTRA YLDQTVVPILLQGLSVLAKERPPNP NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atggcggacgatcacacagatgcggatcagtccatggagggacacacacctgtgtctgaa aaccctcacgcagagtacggcctgacggacaacatccagaggacggtggaaaacgagaag gcgagcgcagagaagatctcaaagcagaaagtggatctgcaggcactgccgaccagagcg tacctggaccagacggtggtcccaatcctgctgcagggcctgtcggtgctcgccaaagag agacctccaaacccc

DBGET integrated database retrieval system