Monopterus albus (swamp eel): 109972027 Help Entry 109972027         CDS       T05607                                  Name (RefSeq) histone H2A-like   KO K11251   histone H2A Organism malb  Monopterus albus (swamp eel) Pathway malb03082   ATP-dependent chromatin remodeling malb04217   Necroptosis Brite KEGG Orthology (KO) [BR:malb00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     109972027  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     109972027  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:malb03036]     109972027   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:malb04147]     109972027 Chromosome and associated proteins [BR:malb03036]  Eukaryotic type   Nucleosome assembly factors    Histones     109972027 Exosome [BR:malb04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    109972027 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  109972027 NCBI-ProteinID:  XP_020476279 LinkDB All DBs Position Unknown AA seq 128 aa AA seqDB search MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TEKPAKSK NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atgtctggtagagggaaaaccggaggcaaagcccgagcaaaggctaagtctcgctcctcc cgtgccggactccagttcccagtgggccgagttcacaggctactgcgcaagggcaactat gcggagcgtgttggtgctggggctccggtgtatctggcggctgtactggaatatctgacc gctgagattctggagttagcaggcaacgcggctagggacaacaagaagaccaggatcatc ccccgccacctccagctggctgtgcgcaacgatgaggagctaaacaagctgctgggaggt gtgaccatcgctcagggaggagtgctgcccaacatccaagctgttcttcttcccaagaag acggagaaaccagcaaagagcaagtga

DBGET integrated database retrieval system