Monopterus albus (swamp eel): 109975012 Help Entry 109975012         CDS       T05607                                  Symbol pold4 Name (RefSeq) DNA polymerase delta subunit 4   KO K03505   DNA polymerase delta subunit 4 Organism malb  Monopterus albus (swamp eel) Pathway malb03030   DNA replication malb03410   Base excision repair malb03420   Nucleotide excision repair malb03430   Mismatch repair malb03440   Homologous recombination Brite KEGG Orthology (KO) [BR:malb00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     109975012 (pold4)    03410 Base excision repair     109975012 (pold4)    03420 Nucleotide excision repair     109975012 (pold4)    03430 Mismatch repair     109975012 (pold4)    03440 Homologous recombination     109975012 (pold4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:malb03032]     109975012 (pold4)    03400 DNA repair and recombination proteins [BR:malb03400]     109975012 (pold4) DNA replication proteins [BR:malb03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     109975012 (pold4) DNA repair and recombination proteins [BR:malb03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       109975012 (pold4)    MMR (mismatch excision repair)     DNA polymerase delta complex      109975012 (pold4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DNA_pol_delta_4 Motif Other DBs NCBI-GeneID:  109975012 NCBI-ProteinID:  XP_020481173 UniProt:  A0A3Q3JUA9 LinkDB All DBs Position Unknown AA seq 106 aa AA seqDB search MTTKRGLITDSFKVVKRAKRGGKREKAPPSPLPQKDAETVREEDLQQLIQFDLDWRFGPC TGISRLQRWERAKHHGLNPPEEIRDLLLQTHADPKYKLSLWSEYPL NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atgacaaccaagcgtggactgataaccgattcattcaaggtggtgaagagagcaaagagg ggagggaaacgagagaaggcacctccttctcctctgccacagaaagacgctgaaacagtc agagaggaggacctgcagcagctcatacagtttgatctggactggagatttgggccctgc acaggtatcagcaggctgcagagatgggagagagcaaagcatcatggtctgaacccacct gaggagatcagagaccttctgctgcaaacacatgctgaccctaagtacaagctgagtctc tggagtgaatatcctttgtga

DBGET integrated database retrieval system