Marinovum algicola: MALG_02136 Help Entry MALG_02136        CDS       T03981                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism malg  Marinovum algicola Pathway malg01100   Metabolic pathways malg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:malg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MALG_02136    00074 Mycolic acid biosynthesis     MALG_02136   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MALG_02136 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Motif Other DBs NCBI-ProteinID:  AKO97304 LinkDB All DBs Position complement(2212078..2212317) Genome browser AA seq 79 aa AA seqDB search MSDVADRVKKIVVEHLGVEEGKVVEGASFIDDLGADSLDTVELVMAFEEEFGIEIPDDAA ENIQTFGDAVKFINDAKEA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgacgtcgcagatcgcgtgaagaaaatcgttgtggaacacctcggtgtcgaagaa ggcaaagttgtcgaaggcgcgtcgttcatcgacgacctcggcgcagacagccttgacacc gtggaactggtgatggcgttcgaagaagaattcggcatcgagatccccgatgacgccgcc gagaacatccagaccttcggcgatgcggtcaaattcatcaacgacgcgaaagaagcgtaa

DBGET integrated database retrieval system