Pseudoduganella albidiflava: EYF70_03745 Help Entry EYF70_03745       CDS       T05903                                  Name (GenBank) hypothetical protein   KO K09892   cell division protein ZapB Organism mali  Pseudoduganella albidiflava Brite KEGG Orthology (KO) [BR:mali00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mali03036]     EYF70_03745 Chromosome and associated proteins [BR:mali03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     EYF70_03745 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB bZIP_2 YabA Mod_r Snapin_Pallidin TSC22 KfrA_N Motif Other DBs NCBI-ProteinID:  QBI00054 LinkDB All DBs Position 893668..893898 Genome browser AA seq 76 aa AA seqDB search MIADFQELSDKIEQLAELALSLRRENAQLRQANAALVAENLGYQKRLAEAHARVSALLEH IPPLETATPEQEDLQS NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgattgcagacttccaagaactttccgacaagatcgagcagttggccgagctggcgctc tcgttgcggcgtgaaaacgcccagctgcgccaggccaatgccgcattggtggctgaaaac ctgggataccagaagcgcctggccgaagcgcatgcgcgcgtgtcggcactgctggaacat atccctccgctggaaacggcaacccccgagcaagaggacctccagtcatga

DBGET integrated database retrieval system