Pseudoduganella albidiflava: EYF70_27915 Help Entry EYF70_27915       CDS       T05903                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mali  Pseudoduganella albidiflava Pathway mali01100   Metabolic pathways mali01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mali00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EYF70_27915    00074 Mycolic acid biosynthesis     EYF70_27915   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EYF70_27915 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QBI04219 LinkDB All DBs Position 6729179..6729427 Genome browser AA seq 82 aa AA seqDB search MYLDEVKQIVIDVLALGPAGRSLDEHSALLGSIPELDSMAVVQLIGALEEQFGFSVDDDE ISAETFATLGSLAAFVKHKLTA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgtatctcgacgaagtaaagcagattgtcatcgacgttctcgcgctgggcccggcgggc cgctcgctggacgagcattccgccctgctgggcagcatcccggaactggattcgatggcg gtcgtccagctgatcggcgcattggaagaacagttcggcttcagtgtcgacgatgacgag atcagcgcggaaaccttcgccacgctgggcagcctggccgccttcgtgaagcacaagctc acggcctga

DBGET integrated database retrieval system