Pseudoduganella albidiflava: EYF70_30785
Help
Entry
EYF70_30785 CDS
T05903
Name
(GenBank) ABC transporter ATP-binding protein/permease
KO
K24821
ATP-binding cassette, subfamily B, heavy metal transporter
Organism
mali
Pseudoduganella albidiflava
Pathway
mali02010
ABC transporters
Brite
KEGG Orthology (KO) [BR:
mali00001
]
09130 Environmental Information Processing
09131 Membrane transport
02010 ABC transporters
EYF70_30785
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
mali02000
]
EYF70_30785
Transporters [BR:
mali02000
]
ABC transporters, eukaryotic type
ABCB (MDR/TAP) subfamily
ABCB-BAC subgroup
EYF70_30785
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ABC_membrane
ABC_tran
SMC_N
AAA_16
AAA_22
AAA_29
ABC_ATPase
RsgA_GTPase
Zeta_toxin
AAA_30
AAA_25
APS_kinase
DEAD
AAA_33
Hit1_C
DUF87
Motif
Other DBs
NCBI-ProteinID:
QBI04720
UniProt:
A0A411X6P4
LinkDB
All DBs
Position
7395678..7397504
Genome browser
AA seq
608 aa
AA seq
DB search
MRRSAYSSEPPPPARPGRSDLATLKTLLPYLLVYKWRVLLALLALVGAKLANVGVPVVLK
HLVDAMTLKPGDPRALLILPVGLLLAYGALRLSTTVFTELREFLFARVTQRAVRTIALQV
FRHLHALSLRFHLNRQTGGMTRDIERGTRGVGSLISYTLFNILPTLVEITLVLAYLVTHY
DVWFSVITFSALVLYIAFTVIVTNWRTHFRRTMNDLDSKANTKAIDSLLNYETVKYFGNE
EYEAKRYDEGLKHYEAAAVRSQTSLSFLNTGQSAIIATAVTLILWRATVGVVDGTMTLGD
LVLVNAFMIQLYIPLNFLGVIYREIKQSLADMERLFSLLDENREVADAKDARPLVTHGAQ
VKFSHVDFSYEAKRQILFDVDFTIQAGTTTAVVGHSGSGKSTLSRLLFRFYEVGGGAITI
DGQDIRAVTQDSLRHAIGIVPQDTVLFNDTIEYNIAYGKPGATHDEIVAAARAASIHDFI
DSLPDGYRTMVGERGLKLSGGEKQRVAIARTLLKNPAILIFDEATSALDSKAEQAIQAQL
KEIAKNRTTMVIAHRLSTVADAHQILVLDHGRIVERGNHPALLAAGGLYAQMWARQQARA
DAPADAAA
NT seq
1827 nt
NT seq
+upstream
nt +downstream
nt
atgcgccgttccgcctactcctccgagccacctccgcccgcccgcccaggccgcagcgat
cttgccaccctgaaaaccctgctgccttacctgctggtctacaaatggcgcgtgctgctg
gccctgctggcgctggtgggcgccaagctggccaatgtcggcgtgccggtcgtgctgaaa
cacctggtcgacgcgatgacgctgaagcccggcgatccccgcgcgctgctgatcctgccg
gtcgggctgctgctcgcctatggcgcgctgcggctgtccaccaccgtgtttaccgagctg
cgcgagttcctgttcgcccgcgtcacgcagcgtgccgtacgcaccatcgcactgcaggtg
ttccgccacctgcacgcgctgtcgctgcgcttccacctgaaccggcagaccggcggcatg
acgcgcgacatcgagcggggcacgcgcggcgtcggctcgctgatctcgtacacgctgttc
aacatcctgcccacgctggtcgagatcacgctggtgctggcctacctcgtcacgcactac
gacgtatggttttcggtgatcacgttcagtgcgctggtgctgtacatcgccttcacggtg
atcgtcaccaactggcgcacgcatttccgccgcaccatgaacgacctggattcgaaggcc
aacacgaaggccatcgattcgctgctcaattatgaaaccgtcaagtatttcggcaacgag
gaatacgaagccaagcgctatgacgaaggattgaagcactacgaggcggcggcggtgcgc
tcgcaaacctcgctgtccttcctcaacacgggccagtcggcgatcatcgccaccgccgtc
acgctgatcctgtggcgcgccacggtcggcgtcgtcgacggcacgatgaccctgggcgac
ctggtgctggtcaacgccttcatgatccagctgtacatcccgctcaatttcctgggcgtg
atctaccgcgagatcaagcagagcctggccgacatggaacgcctgttctcgctgctcgac
gagaaccgcgaagtggccgatgcgaaggatgcccggcccctggtcacgcacggcgcccag
gtgaaattctcgcatgtcgacttcagctacgaagccaagcggcagatcctgttcgacgtc
gacttcacgatccaggcgggcaccaccaccgccgtcgtcggccatagcggttccggcaag
tccacgctgtcgcgcctgctgttccgcttctacgaagtcggcggcggcgcgatcacgatc
gacggccaggatatccgtgcggtcacccaggattcgctgcgccacgcgatcggcatcgtg
ccgcaggataccgtgctgttcaacgacacgatcgaatacaacatcgcctacggcaagccg
ggcgccacgcatgacgagatcgtggccgcggcccgggcggcatcgatccacgacttcatc
gacagtctgcccgacggctaccgcacgatggtgggcgaacgggggctgaaactgtccggc
ggcgaaaagcagcgcgtggccatcgcccgcacgctgctgaagaacccggcgattttgatc
ttcgacgaagccacctccgcgcttgattccaaggcggagcaggcgatccaggcccagctg
aaggagatcgcgaaaaaccgcacgacgatggtgatcgcccaccgcctgtccaccgtggcc
gatgcgcaccagatcctggtgctggaccatggccgtatcgtcgaacgcggcaaccatccc
gccttgctggccgctggcgggctgtatgcgcagatgtgggcgcgccagcaagcccgcgcc
gacgctccggccgatgccgcggcatga
DBGET
integrated database retrieval system