Mameliella alba: KU6B_21600 Help Entry KU6B_21600        CDS       T06509                                  Name (GenBank) hypothetical protein   KO K03060   DNA-directed RNA polymerase subunit omega [EC:2.7.7.6] Organism malu  Mameliella alba Pathway malu03020   RNA polymerase Brite KEGG Orthology (KO) [BR:malu00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     KU6B_21600  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:malu03021]     KU6B_21600    03400 DNA repair and recombination proteins [BR:malu03400]     KU6B_21600 Enzymes [BR:malu01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.6  DNA-directed RNA polymerase      KU6B_21600 Transcription machinery [BR:malu03021]  Prokaryotic type   Bacterial type    RNA polymerase     Core subunits      KU6B_21600 DNA repair and recombination proteins [BR:malu03400]  Prokaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase complex (RNAP)       KU6B_21600 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RNA_pol_Rpb6 Motif Other DBs NCBI-ProteinID:  BBU55895 UniProt:  A0A6F8Q688 LinkDB All DBs Position 2129840..2130079 Genome browser AA seq 79 aa AA seqDB search MNPFVAIDAQQAVPDRFALVLAASARSRALNAGAEPRVEPKRQATEELALEEIATGAISQ EELLPFLPAPAPKRLARPH NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgaatcccttcgttgcaattgatgcccagcaggcggtgcccgatcgtttcgctctggtc ctcgccgcgagcgcccgcagccgggcgctgaacgccggggcagaaccgcgggtcgaacct aaacggcaagccaccgaagagcttgccttggaagagatcgcgaccggcgcgatttcgcag gaggagttgttgcccttcctgcctgcgccggcgcccaagcggctggctcggccgcattga

DBGET integrated database retrieval system