Mameliella alba: KU6B_22550 Help Entry KU6B_22550        CDS       T06509                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism malu  Mameliella alba Pathway malu01100   Metabolic pathways malu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:malu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KU6B_22550 (acpP)    00074 Mycolic acid biosynthesis     KU6B_22550 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KU6B_22550 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Delta_lysin Motif Other DBs NCBI-ProteinID:  BBU55990 LinkDB All DBs Position 2215346..2215579 Genome browser AA seq 77 aa AA seqDB search MSDIADRVKKIVVEHLSVEEEKVTESASFIDDLGADSLDTVELVMAFEEEFGIEIPDDAA ETIQTFGDAVKFISDAQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcgacatcgcagatcgcgtgaagaagattgtggtcgagcacctgagcgtcgaagaa gagaaagtgacggaatcggcttccttcatcgacgatctgggcgccgacagcctggacacc gtggaactggtgatggccttcgaagaagagttcggcatcgagatccccgacgacgcggcc gaaaccatccagaccttcggcgacgcggtcaagttcatctcggacgcgcagtaa

DBGET integrated database retrieval system