Mameliella alba: KU6B_42790 Help Entry KU6B_42790        CDS       T06509                                  Name (GenBank) hypothetical protein   KO K00626   acetyl-CoA C-acetyltransferase [EC:2.3.1.9] Organism malu  Mameliella alba Pathway malu00071   Fatty acid degradation malu00280   Valine, leucine and isoleucine degradation malu00310   Lysine degradation malu00362   Benzoate degradation malu00380   Tryptophan metabolism malu00620   Pyruvate metabolism malu00630   Glyoxylate and dicarboxylate metabolism malu00650   Butanoate metabolism malu00720   Other carbon fixation pathways malu00900   Terpenoid backbone biosynthesis malu01100   Metabolic pathways malu01110   Biosynthesis of secondary metabolites malu01120   Microbial metabolism in diverse environments malu01200   Carbon metabolism malu01212   Fatty acid metabolism malu02020   Two-component system Module malu_M00373   Ethylmalonyl pathway Brite KEGG Orthology (KO) [BR:malu00001]  09100 Metabolism   09101 Carbohydrate metabolism    00620 Pyruvate metabolism     KU6B_42790    00630 Glyoxylate and dicarboxylate metabolism     KU6B_42790    00650 Butanoate metabolism     KU6B_42790   09102 Energy metabolism    00720 Other carbon fixation pathways     KU6B_42790   09103 Lipid metabolism    00071 Fatty acid degradation     KU6B_42790   09105 Amino acid metabolism    00280 Valine, leucine and isoleucine degradation     KU6B_42790    00310 Lysine degradation     KU6B_42790    00380 Tryptophan metabolism     KU6B_42790   09109 Metabolism of terpenoids and polyketides    00900 Terpenoid backbone biosynthesis     KU6B_42790   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     KU6B_42790  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     KU6B_42790  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:malu04147]     KU6B_42790 Enzymes [BR:malu01000]  2. Transferases   2.3  Acyltransferases    2.3.1  Transferring groups other than aminoacyl groups     2.3.1.9  acetyl-CoA C-acetyltransferase      KU6B_42790 Exosome [BR:malu04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    KU6B_42790 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thiolase_N Motif Other DBs NCBI-ProteinID:  BBU58014 LinkDB All DBs Position complement(4199081..4199326) Genome browser AA seq 81 aa AA seqDB search METVVITGASRTPMGGFQGVFAEQAASTLGGAAIRAALSQAGRPAVDELLMGCVLPAGQG QAPRARPVLRRDWAKRCRPQR NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggaaactgtcgtgatcaccggggcgtcgcggacgccgatggggggctttcagggggtt ttcgccgaacaggcggccagcactttgggtggcgcggcgatccgcgcggcgctgtcgcag gcgggtcggcccgcggtcgacgaactgctgatgggctgcgtactgccggcgggacagggg caggccccgcgcgccaggccggttttgcggcgggactgggcgaagaggtgccggccacaa cgctga

DBGET integrated database retrieval system