Mameliella alba: KU6B_44200
Help
Entry
KU6B_44200 CDS
T06509
Name
(GenBank) myo-inositol 2-dehydrogenase
Organism
malu
Mameliella alba
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
GFO_IDH_MocA_C3
GFO_IDH_MocA
GFO_IDH_MocA_C
NAD_binding_3
Motif
Other DBs
NCBI-ProteinID:
BBU58155
LinkDB
All DBs
Position
complement(4327529..4328653)
Genome browser
AA seq
374 aa
AA seq
DB search
MAGLGIGLIGTGFMGKTHALAWGAARAVLGRDLPEVRLEMLCDTPQDRAAEMADQFGFAR
ATGDWRALVTDPAVDVVSITTPNNLHHEMACTALRAGKHVWCEKPMALTLAEAEEMAQAA
HEAGTVTMVGYNYIRNPAFLHAKKLIEEGRIGRVVHVRGWVDEDYQADPDLPWTWRARLQ
DAGLGTLGDLGCHLVSMVVGLAGPIESLVADTQIIHETRPLPDGSGRGAVENEDTATALL
RFANGAHGSISSSRSAWGRKNKLDWEIHGTRGMICFAQERMNELQVYLNEGPKAEQGFRT
ILSGPEHPPFGAFVPAPGHQLGFGDLKTIEAADLLTAIRDGGQAYPSMQDALVFERVIHA
IADSARRGCCRVTL
NT seq
1125 nt
NT seq
+upstream
nt +downstream
nt
atggcaggattggggatcgggctgatcgggacgggcttcatgggcaagacccatgcattg
gcctggggcgccgcgcgggcggttctcgggcgcgacctgcccgaagtgcgtctggagatg
ctctgcgatacgccccaggaccgagccgcagagatggcggaccagttcggctttgcccgt
gcgacaggggattggcgcgcgcttgtcaccgatccggcggtcgacgtggtctcgatcacc
acgccgaacaacctgcatcacgaaatggcctgcaccgcgctcagggcgggcaaacatgtc
tggtgcgaaaagccgatggcgctgaccctggccgaggccgaagagatggcgcaggcggcg
catgaggccgggaccgtcacgatggtaggctacaattacatccggaacccggcctttctg
cacgcgaaaaagctgatcgaggaggggcgcatcggccgtgtcgtgcatgtgcgcggctgg
gtggacgaagattaccaggctgaccccgatctgccctggacctggcgtgcgcggctgcag
gacgcgggccttggcacgctgggcgacctgggctgtcacctggtgtcgatggtggttggc
cttgccggaccgatcgagagccttgtcgccgacacgcagatcatccacgaaacgcgcccc
ttgcccgacggatcgggccggggcgcggtcgagaacgaggatacggcgacggccctcttg
cgatttgccaatggcgcgcatgggtcgatctccagttctcggtcggcctggggccgcaag
aacaagctcgattgggagatccacggcaccagggggatgatctgctttgcacaggagcgg
atgaacgaattgcaggtctacctgaacgaggggcccaaggcggaacagggattccgcacg
atcctgtccggcccggaacatccgccctttggcgcctttgtgccagcgcctgggcatcag
ctgggctttggcgacctcaagaccatcgaggcggcggatctgctaacggccatccgcgac
ggtgggcaggcctatccgtcgatgcaggacgccttggtgttcgaacgtgtgatccacgcc
atcgccgacagtgcccggcggggctgttgccgggtgaccctctag
DBGET
integrated database retrieval system